General Information

  • ID:  hor005242
  • Uniprot ID:  P43511
  • Protein name:  Pheromone biosynthesis-activating neuropeptide
  • Gene name:  NA
  • Organism:  Lymantria dispar (Gypsy moth) (Porthetria dispar)
  • Family:  pyrokinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Lymantria (genus), Lymantriinae (subfamily), Erebidae (family), Noctuoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0042811 pheromone biosynthetic process
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  LADDMPATMADQEVYRPEPEQIDSRNKYFSPRL
  • Length:  33(1-33)
  • Propeptide:  LADDMPATMADQEVYRPEPEQIDSRNKYFSPRL
  • Signal peptide:  NA
  • Modification:  T33 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in the control of pheromone production in females.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P43511-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P43511-F1.pdbhor005242_AF2.pdbhor005242_ESM.pdb

Physical Information

Mass: 445526 Formula: C168H260N46O56S2
Absent amino acids: CGHW Common amino acids: DP
pI: 4.17 Basic residues: 4
Polar residues: 6 Hydrophobic residues: 8
Hydrophobicity: -107.27 Boman Index: -10108
Half-Life: 5.5 hour Half-Life Yeast: 3 min
Half-Life E.Coli: 2 min Aliphatic Index 53.33
Instability Index: 8753.03 Extinction Coefficient cystines: 2980
Absorbance 280nm: 93.13

Literature

  • PubMed ID:  7981730
  • Title:  Isolation and identification of a pheromonotropic neuropeptide from the brain-suboesophageal ganglion complex of Lymantria dispar: a new member of the PBAN family.